SCOP 1.67: Domain d1vhka2: 1vhk A:74-253

Lineage for d1vhka2 (1vhk A:74-253)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (5 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.5: YggJ C-terminal domain-like [89632] (2 proteins)
   contains extra strand (3) in the parallel beta-sheet, order 321546; similar dimerisation to the MTH1 domain

6. Protein Hypothetical protein YqeU [102281] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [102282] (1 PDB entry)

8. Domain d1vhka2: 1vhk A:74-253 [100681]
   Other proteins in same PDB: d1vhka1, d1vhkb1, d1vhkc1, d1vhkd1

Details for d1vhka2

PDB Entry: 1vhk, 2.6 Å

PDB Description: crystal structure of an hypothetical protein

SCOP Domain Sequences for d1vhka2:

Sequence, based on SEQRES records:

>d1vhka2 c.116.1.5 (A:74-253) Hypothetical protein YqeU {Bacillus subtilis}
nrelpikvyiasglpkgdklewiiqkgtelgahafipfqaarsvvklddkkakkkrerwt
kiakeaaeqsyrnevprvmdvhsfqqllqrmqdfdkcvvayeesskqgeisafsaivssl
pkgssllivfgpegglteaeverlteqdgvtcglgprilrtetaplyalsaisyqtellr

Sequence, based on observed residues (ATOM records):

>d1vhka2 c.116.1.5 (A:74-253) Hypothetical protein YqeU {Bacillus subtilis}
nrelpikvyiasglpkgdklewiiqkgtelgahafipfqaarsvvkrerwtkiakeaaeq
syrnevprvmdvhsfqqllqrmqdfdkcvvayesafsaivsslpkgssllivfgpegglt
eaeverlteqdgvtcglgprilrtetaplyalsaisyqtellr

Timeline for d1vhka2:

• d1vhka2 is new in SCOP 1.67
  
• d1vhka2 appears in SCOP 1.69
  
• d1vhka2 appears in the current release, SCOPe 2.08