Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
Superfamily c.116.1: alpha/beta knot [75217] (5 families) known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
Family c.116.1.5: YggJ C-terminal domain-like [89632] (2 proteins) contains extra strand (3) in the parallel beta-sheet, order 321546; similar dimerisation to the MTH1 domain |
Protein Hypothetical protein YqeU [102281] (1 species) |
Species Bacillus subtilis [TaxId:1423] [102282] (1 PDB entry) |
Domain d1vhka2: 1vhk A:74-253 [100681] Other proteins in same PDB: d1vhka1, d1vhkb1, d1vhkc1, d1vhkd1 |
PDB Entry: 1vhk (more details), 2.6 Å
SCOP Domain Sequences for d1vhka2:
Sequence, based on SEQRES records: (download)
>d1vhka2 c.116.1.5 (A:74-253) Hypothetical protein YqeU {Bacillus subtilis} nrelpikvyiasglpkgdklewiiqkgtelgahafipfqaarsvvklddkkakkkrerwt kiakeaaeqsyrnevprvmdvhsfqqllqrmqdfdkcvvayeesskqgeisafsaivssl pkgssllivfgpegglteaeverlteqdgvtcglgprilrtetaplyalsaisyqtellr
>d1vhka2 c.116.1.5 (A:74-253) Hypothetical protein YqeU {Bacillus subtilis} nrelpikvyiasglpkgdklewiiqkgtelgahafipfqaarsvvkrerwtkiakeaaeq syrnevprvmdvhsfqqllqrmqdfdkcvvayesafsaivsslpkgssllivfgpegglt eaeverlteqdgvtcglgprilrtetaplyalsaisyqtellr
Timeline for d1vhka2: