Lineage for d1vhje_ (1vhj E:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 996821Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 996837Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 996838Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 996948Protein Purine nucleoside phosphorylase, PNP [53169] (10 species)
  7. 997135Species Vibrio cholerae [TaxId:666] [102499] (2 PDB entries)
  8. 997146Domain d1vhje_: 1vhj E: [100678]
    structural genomics

Details for d1vhje_

PDB Entry: 1vhj (more details), 2.23 Å

PDB Description: crystal structure of purine nucleoside phosphorylase
PDB Compounds: (E:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d1vhje_:

Sequence, based on SEQRES records: (download)

>d1vhje_ c.56.2.1 (E:) Purine nucleoside phosphorylase, PNP {Vibrio cholerae [TaxId: 666]}
atphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrrisvm
ghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnrirf
kdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivgvem
eaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq

Sequence, based on observed residues (ATOM records): (download)

>d1vhje_ c.56.2.1 (E:) Purine nucleoside phosphorylase, PNP {Vibrio cholerae [TaxId: 666]}
atphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrrisvm
ghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnrirf
kdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivgvem
eaagiygvaaeygakalaictvsdhiktgeerqntfnemieialdsvligdq

SCOPe Domain Coordinates for d1vhje_:

Click to download the PDB-style file with coordinates for d1vhje_.
(The format of our PDB-style files is described here.)

Timeline for d1vhje_: