Lineage for d1vhjb_ (1vhj B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 398073Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 398089Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 398090Family c.56.2.1: Purine and uridine phosphorylases [53168] (5 proteins)
  6. 398141Protein Purine nucleoside phosphorylase, PNP [53169] (7 species)
  7. 398282Species Vibrio cholerae [TaxId:666] [102499] (2 PDB entries)
  8. 398290Domain d1vhjb_: 1vhj B: [100675]

Details for d1vhjb_

PDB Entry: 1vhj (more details), 2.23 Å

PDB Description: crystal structure of purine nucleoside phosphorylase

SCOP Domain Sequences for d1vhjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhjb_ c.56.2.1 (B:) Purine nucleoside phosphorylase, PNP {Vibrio cholerae}
atphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrrisvm
ghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnrirf
kdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivgvem
eaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq

SCOP Domain Coordinates for d1vhjb_:

Click to download the PDB-style file with coordinates for d1vhjb_.
(The format of our PDB-style files is described here.)

Timeline for d1vhjb_: