SCOPe 2.06: Domain d1vhgb_: 1vhg B:

Lineage for d1vhgb_ (1vhg B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein ADP compounds hydrolase NudE [103203] (1 species)

7. Species Escherichia coli [TaxId:562] [103204] (2 PDB entries)

8. Domain d1vhgb_: 1vhg B: [100673]
   structural genomics

Details for d1vhgb_

PDB Entry: 1vhg, 2.7 Å

PDB Description: crystal structure of adp compounds hydrolase

PDB Compounds: (B:) ADP compounds hydrolase nudE

SCOPe Domain Sequences for d1vhgb_:

Sequence; same for both SEQRES and ATOM records:

>d1vhgb_ d.113.1.1 (B:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]}
skslqkptilnvetvarsrlftvesvdlefsngvrrvyermrptnreavmivpivddhli
lireyavgtesyelgfskglidpgesvyeaanrelkeevgfgandltflkklsmapsyfs
skmnivvaqdlypeslegdepeplpqvrwplahmmdlledpdfnearnvsalflvrewlk
gqgrv

Timeline for d1vhgb_:

• d1vhgb_ first appeared in SCOP 1.67
  
• d1vhgb_ appears in SCOPe 2.05
  
• d1vhgb_ appears in SCOPe 2.07
  
• d1vhgb_ appears in the current release, SCOPe 2.08