Lineage for d1vhgb_ (1vhg B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971446Protein ADP compounds hydrolase NudE [103203] (1 species)
  7. 2971447Species Escherichia coli [TaxId:562] [103204] (2 PDB entries)
  8. 2971451Domain d1vhgb_: 1vhg B: [100673]
    structural genomics
    has additional subdomain(s) that are not in the common domain

Details for d1vhgb_

PDB Entry: 1vhg (more details), 2.7 Å

PDB Description: crystal structure of adp compounds hydrolase
PDB Compounds: (B:) ADP compounds hydrolase nudE

SCOPe Domain Sequences for d1vhgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhgb_ d.113.1.1 (B:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]}
skslqkptilnvetvarsrlftvesvdlefsngvrrvyermrptnreavmivpivddhli
lireyavgtesyelgfskglidpgesvyeaanrelkeevgfgandltflkklsmapsyfs
skmnivvaqdlypeslegdepeplpqvrwplahmmdlledpdfnearnvsalflvrewlk
gqgrv

SCOPe Domain Coordinates for d1vhgb_:

Click to download the PDB-style file with coordinates for d1vhgb_.
(The format of our PDB-style files is described here.)

Timeline for d1vhgb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vhga_