Lineage for d1vhga_ (1vhg A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731929Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 731930Superfamily d.113.1: Nudix [55811] (7 families) (S)
  5. 731931Family d.113.1.1: MutT-like [55812] (16 proteins)
  6. 731935Protein ADP compounds hydrolase NudE [103203] (1 species)
  7. 731936Species Escherichia coli [TaxId:562] [103204] (2 PDB entries)
  8. 731939Domain d1vhga_: 1vhg A: [100672]

Details for d1vhga_

PDB Entry: 1vhg (more details), 2.7 Å

PDB Description: crystal structure of adp compounds hydrolase
PDB Compounds: (A:) ADP compounds hydrolase nudE

SCOP Domain Sequences for d1vhga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhga_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]}
skslqkptilnvetvarsrlftvesvdlefsngvrrvyermrptnreavmivpivddhli
lireyavgtesyelgfskglidpgesvyeaanrelkeevgfgandltflkklsmapsyfs
skmnivvaqdlypeslegdepeplpqvrwplahmmdlledpdfnearnvsalflvrewlk
gqgrv

SCOP Domain Coordinates for d1vhga_:

Click to download the PDB-style file with coordinates for d1vhga_.
(The format of our PDB-style files is described here.)

Timeline for d1vhga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vhgb_