SCOPe 2.08: Domain d1vhga_: 1vhg A:

Lineage for d1vhga_ (1vhg A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein ADP compounds hydrolase NudE [103203] (1 species)

7. Species Escherichia coli [TaxId:562] [103204] (2 PDB entries)

8. Domain d1vhga_: 1vhg A: [100672]
   structural genomics
   has additional subdomain(s) that are not in the common domain

Details for d1vhga_

PDB Entry: 1vhg, 2.7 Å

PDB Description: crystal structure of adp compounds hydrolase

PDB Compounds: (A:) ADP compounds hydrolase nudE

SCOPe Domain Sequences for d1vhga_:

Sequence; same for both SEQRES and ATOM records:

>d1vhga_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]}
skslqkptilnvetvarsrlftvesvdlefsngvrrvyermrptnreavmivpivddhli
lireyavgtesyelgfskglidpgesvyeaanrelkeevgfgandltflkklsmapsyfs
skmnivvaqdlypeslegdepeplpqvrwplahmmdlledpdfnearnvsalflvrewlk
gqgrv

Timeline for d1vhga_:

• d1vhga_ first appeared in SCOP 1.67
  
• d1vhga_ appears in SCOPe 2.07