SCOPe 2.04: Domain d1vhfa_: 1vhf A:

Lineage for d1vhfa_ (1vhf A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)

6. Protein Hypothetical protein TM1056 [75435] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [75436] (3 PDB entries)

8. Domain d1vhfa_: 1vhf A: [100671]
   structural genomics

Details for d1vhfa_

PDB Entry: 1vhf, 1.54 Å

PDB Description: crystal structure of periplasmic divalent cation tolerance protein

PDB Compounds: (A:) Periplasmic divalent cation tolerance protein

SCOPe Domain Sequences for d1vhfa_:

Sequence; same for both SEQRES and ATOM records:

>d1vhfa_ d.58.5.2 (A:) Hypothetical protein TM1056 {Thermotoga maritima [TaxId: 2336]}
slilvystfpneekaleigrkllekrliacfnafeirsgywwkgeivqdkewaaifktte
ekekelyeelrklhpyetpaiftlkvenvlteymnwlresv

Timeline for d1vhfa_:

• d1vhfa_ first appeared in SCOP 1.67
  
• d1vhfa_ appears in SCOPe 2.03
  
• d1vhfa_ appears in SCOPe 2.05
  
• d1vhfa_ appears in the current release, SCOPe 2.08, called d1vhfa1