Lineage for d1vhfa1 (1vhf A:2-100)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.5: GlnB-like [54913] (6 families) 
form timeric structures with the orthogonally packed beta-sheets
Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins) 
Protein Hypothetical protein TM1056 [75435] (1 species) Species Thermotoga maritima [TaxId:2336] [75436] (3 PDB entries) 
Domain d1vhfa1: 1vhf A:2-100 [100671]
Other proteins in same PDB: d1vhfa2
structural genomics
Details for d1vhfa1
PDB Entry: 1vhf (more details), 1.54 Å
PDB Description: crystal structure of periplasmic divalent cation tolerance protein
PDB Compounds: (A:) Periplasmic divalent cation tolerance proteinSCOPe Domain Sequences for d1vhfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vhfa1 d.58.5.2 (A:2-100) Hypothetical protein TM1056 {Thermotoga maritima [TaxId: 2336]}
ilvystfpneekaleigrkllekrliacfnafeirsgywwkgeivqdkewaaifktteek
ekelyeelrklhpyetpaiftlkvenvlteymnwlresv
SCOPe Domain Coordinates for d1vhfa1:
Click to download the PDB-style file with coordinates for d1vhfa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vhfa1:
- d1vhfa1 first appeared in SCOP 1.67, called d1vhfa_
- d1vhfa1 appears in SCOPe 2.07
View in 3D
