Lineage for d1vhea2 (1vhe A:3-72,A:163-367)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 398073Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 398389Superfamily c.56.5: Zn-dependent exopeptidases [53187] (6 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 398477Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (9 proteins)
  6. 398505Protein Hypothetical protein YsdC, catalytic domain [102513] (1 species)
    contains insert beta-barrel domain
  7. 398506Species Bacillus subtilis [TaxId:1423] [102514] (1 PDB entry)
  8. 398507Domain d1vhea2: 1vhe A:3-72,A:163-367 [100670]
    Other proteins in same PDB: d1vhea1
    structural genomics
    complexed with zn

Details for d1vhea2

PDB Entry: 1vhe (more details), 1.9 Å

PDB Description: Crystal structure of a aminopeptidase/glucanase homolog

SCOP Domain Sequences for d1vhea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhea2 c.56.5.4 (A:3-72,A:163-367) Hypothetical protein YsdC, catalytic domain {Bacillus subtilis}
kldetltmlkdltdakgipgnerevrqvmksyiepfadevttdrlgsliakktgaengpk
imiaghldevXphfeftvmnnekfllakawdnrigcaiaidvlrnlqntdhpnivygvgt
vqeevglrgaktaahtiqpdiafgvdvgiagdtpgisekeaqskmgkgpqiivydasmvs
hkglrdavvataeeagipyqfdaiagggtdsgaihltangvpalsitiatryihthaaml
hrddyenavklitevikkldrktvdeityqeggshh

SCOP Domain Coordinates for d1vhea2:

Click to download the PDB-style file with coordinates for d1vhea2.
(The format of our PDB-style files is described here.)

Timeline for d1vhea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vhea1