SCOPe 2.08: Domain d1vhea2: 1vhe A:3-72,A:163-361

Lineage for d1vhea2 (1vhe A:3-72,A:163-361)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)

6. Protein Hypothetical protein YsdC, catalytic domain [102513] (1 species)
   contains insert beta-barrel domain

7. Species Bacillus subtilis [TaxId:1423] [102514] (1 PDB entry)

8. Domain d1vhea2: 1vhe A:3-72,A:163-361 [100670]
   Other proteins in same PDB: d1vhea1, d1vhea3
   structural genomics
   complexed with zn

Details for d1vhea2

PDB Entry: 1vhe, 1.9 Å

PDB Description: Crystal structure of a aminopeptidase/glucanase homolog

PDB Compounds: (A:) aminopeptidase/glucanase homolog

SCOPe Domain Sequences for d1vhea2:

Sequence; same for both SEQRES and ATOM records:

>d1vhea2 c.56.5.4 (A:3-72,A:163-361) Hypothetical protein YsdC, catalytic domain {Bacillus subtilis [TaxId: 1423]}
kldetltmlkdltdakgipgnerevrqvmksyiepfadevttdrlgsliakktgaengpk
imiaghldevXphfeftvmnnekfllakawdnrigcaiaidvlrnlqntdhpnivygvgt
vqeevglrgaktaahtiqpdiafgvdvgiagdtpgisekeaqskmgkgpqiivydasmvs
hkglrdavvataeeagipyqfdaiagggtdsgaihltangvpalsitiatryihthaaml
hrddyenavklitevikkldrktvdeityq

Timeline for d1vhea2:

• d1vhea2 first appeared in SCOP 1.67
  
• d1vhea2 appears in SCOPe 2.07