Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins) |
Protein Hypothetical protein YsdC, catalytic domain [102513] (1 species) contains insert beta-barrel domain |
Species Bacillus subtilis [TaxId:1423] [102514] (1 PDB entry) |
Domain d1vhea2: 1vhe A:3-72,A:163-361 [100670] Other proteins in same PDB: d1vhea1, d1vhea3 structural genomics complexed with zn |
PDB Entry: 1vhe (more details), 1.9 Å
SCOPe Domain Sequences for d1vhea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vhea2 c.56.5.4 (A:3-72,A:163-361) Hypothetical protein YsdC, catalytic domain {Bacillus subtilis [TaxId: 1423]} kldetltmlkdltdakgipgnerevrqvmksyiepfadevttdrlgsliakktgaengpk imiaghldevXphfeftvmnnekfllakawdnrigcaiaidvlrnlqntdhpnivygvgt vqeevglrgaktaahtiqpdiafgvdvgiagdtpgisekeaqskmgkgpqiivydasmvs hkglrdavvataeeagipyqfdaiagggtdsgaihltangvpalsitiatryihthaaml hrddyenavklitevikkldrktvdeityq
Timeline for d1vhea2: