Lineage for d1vhea1 (1vhe A:73-162)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
barrel, closed; n=6, S=8; greek-key
Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) 
Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (2 proteins) Protein Hypothetical protein YsdC [101823] (1 species) Species Bacillus subtilis [TaxId:1423] [101824] (1 PDB entry) 
Domain d1vhea1: 1vhe A:73-162 [100669]
Other proteins in same PDB: d1vhea2
structural genomics
Details for d1vhea1
PDB Entry: 1vhe (more details), 1.9 Å
PDB Description: Crystal structure of a aminopeptidase/glucanase homolog
SCOP Domain Sequences for d1vhea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vhea1 b.49.3.1 (A:73-162) Hypothetical protein YsdC {Bacillus subtilis}
gfmvtqitdkgfirfqtvggwwaqvmlaqrvtivtkkgeitgvigskpphilspearkks
veikdmfidigassreealewgvlpgdmiv
SCOP Domain Coordinates for d1vhea1:
Click to download the PDB-style file with coordinates for d1vhea1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vhea1:
- d1vhea1 first appeared in SCOP 1.67
- d1vhea1 appears in SCOP 1.71
- d1vhea1 appears in the current release, SCOPe 2.08
View in 3D
