Lineage for d1vhea1 (1vhe A:73-162)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 377221Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 377355Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) (S)
  5. 377356Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (2 proteins)
  6. 377357Protein Hypothetical protein YsdC [101823] (1 species)
  7. 377358Species Bacillus subtilis [TaxId:1423] [101824] (1 PDB entry)
  8. 377359Domain d1vhea1: 1vhe A:73-162 [100669]
    Other proteins in same PDB: d1vhea2
    structural genomics
    complexed with zn

Details for d1vhea1

PDB Entry: 1vhe (more details), 1.9 Å

PDB Description: Crystal structure of a aminopeptidase/glucanase homolog

SCOP Domain Sequences for d1vhea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhea1 b.49.3.1 (A:73-162) Hypothetical protein YsdC {Bacillus subtilis}
gfmvtqitdkgfirfqtvggwwaqvmlaqrvtivtkkgeitgvigskpphilspearkks
veikdmfidigassreealewgvlpgdmiv

SCOP Domain Coordinates for d1vhea1:

Click to download the PDB-style file with coordinates for d1vhea1.
(The format of our PDB-style files is described here.)

Timeline for d1vhea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vhea2