Lineage for d1vhda1 (1vhd A:2-359)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624884Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 2624885Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) (S)
  5. 2624915Family e.22.1.2: Iron-containing alcohol dehydrogenase [69892] (6 proteins)
    Pfam PF00465
  6. 2624916Protein Alcohol dehydrogenase TM0920 [75612] (1 species)
  7. 2624917Species Thermotoga maritima [TaxId:2336] [75613] (3 PDB entries)
  8. 2624919Domain d1vhda1: 1vhd A:2-359 [100667]
    Other proteins in same PDB: d1vhda2, d1vhda3, d1vhdb2, d1vhdb3
    structural genomics; high-resolution structure
    complexed with cac, nap, zn

Details for d1vhda1

PDB Entry: 1vhd (more details), 1.6 Å

PDB Description: Crystal structure of an iron containing alcohol dehydrogenase
PDB Compounds: (A:) Alcohol dehydrogenase, iron-containing

SCOPe Domain Sequences for d1vhda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhda1 e.22.1.2 (A:2-359) Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxId: 2336]}
wefymptdvffgekilekrgniidllgkralvvtgkssskkngslddlkklldeteisye
ifdeveenpsfdnvmkaveryrndsfdfvvglgggspmdfakavavllkekdlsvedlyd
rekvkhwlpvveipttagtgsevtpysiltdpegnkrgctlmfpvyafldprytysmsde
ltlstgvdalshavegylsrkstppsdalaieamkiihrnlpkaiegnrearkkmfvasc
lagmviaqtgttlahalgyplttekgikhgkatgmvlpfvmevmkeeipekvdtvnhifg
gsllkflkelglyekvavsseelekwvekgsrakhlkntpgtftpekirniyrealgv

SCOPe Domain Coordinates for d1vhda1:

Click to download the PDB-style file with coordinates for d1vhda1.
(The format of our PDB-style files is described here.)

Timeline for d1vhda1: