SCOPe 2.08: Domain d1vhce1: 1vhc E:2-212

Lineage for d1vhce1 (1vhc E:2-212)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Hypothetical protein HI0047 [102092] (1 species)
   putative KHG/KDPG aldolase

7. Species Haemophilus influenzae [TaxId:727] [102093] (1 PDB entry)

8. Domain d1vhce1: 1vhc E:2-212 [100665]
   Other proteins in same PDB: d1vhca2, d1vhcb2, d1vhcc2, d1vhcd2, d1vhce2, d1vhcf2, d1vhcf3
   structural genomics; high-resolution structure

Details for d1vhce1

PDB Entry: 1vhc, 1.89 Å

PDB Description: crystal structure of a putative khg/kdpg aldolase

PDB Compounds: (E:) Putative KHG/KDPG aldolase

SCOPe Domain Sequences for d1vhce1:

Sequence; same for both SEQRES and ATOM records:

>d1vhce1 c.1.10.1 (E:2-212) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]}
syttqqiieklrelkivpvialdnaddilpladtlaknglsvaeitfrseaaadairllr
anrpdfliaagtvltaeqvvlakssgadfvvtpglnpkivklcqdlnfpitpgvnnpmai
eialemgisavkffpaeasggvkmikallgpyaqlqimptggiglhnirdylaipnivac
ggswfvekkliqsnnwdeigrlvrevidiik

Timeline for d1vhce1:

• d1vhce1 first appeared in SCOP 1.67, called d1vhce_
  
• d1vhce1 appears in SCOPe 2.07