![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
![]() | Protein Hypothetical protein HI0047 [102092] (1 species) putative KHG/KDPG aldolase |
![]() | Species Haemophilus influenzae [TaxId:727] [102093] (1 PDB entry) |
![]() | Domain d1vhcd1: 1vhc D:2-212 [100664] Other proteins in same PDB: d1vhca2, d1vhcb2, d1vhcc2, d1vhcd2, d1vhce2, d1vhcf2, d1vhcf3 structural genomics; high-resolution structure |
PDB Entry: 1vhc (more details), 1.89 Å
SCOPe Domain Sequences for d1vhcd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vhcd1 c.1.10.1 (D:2-212) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} syttqqiieklrelkivpvialdnaddilpladtlaknglsvaeitfrseaaadairllr anrpdfliaagtvltaeqvvlakssgadfvvtpglnpkivklcqdlnfpitpgvnnpmai eialemgisavkffpaeasggvkmikallgpyaqlqimptggiglhnirdylaipnivac ggswfvekkliqsnnwdeigrlvrevidiik
Timeline for d1vhcd1: