Lineage for d1vhcc1 (1vhc C:2-212)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2443025Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2443469Protein Hypothetical protein HI0047 [102092] (1 species)
    putative KHG/KDPG aldolase
  7. 2443470Species Haemophilus influenzae [TaxId:727] [102093] (1 PDB entry)
  8. 2443473Domain d1vhcc1: 1vhc C:2-212 [100663]
    Other proteins in same PDB: d1vhca2, d1vhcb2, d1vhcc2, d1vhcd2, d1vhce2, d1vhcf2, d1vhcf3
    structural genomics; high-resolution structure

Details for d1vhcc1

PDB Entry: 1vhc (more details), 1.89 Å

PDB Description: crystal structure of a putative khg/kdpg aldolase
PDB Compounds: (C:) Putative KHG/KDPG aldolase

SCOPe Domain Sequences for d1vhcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhcc1 c.1.10.1 (C:2-212) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]}
syttqqiieklrelkivpvialdnaddilpladtlaknglsvaeitfrseaaadairllr
anrpdfliaagtvltaeqvvlakssgadfvvtpglnpkivklcqdlnfpitpgvnnpmai
eialemgisavkffpaeasggvkmikallgpyaqlqimptggiglhnirdylaipnivac
ggswfvekkliqsnnwdeigrlvrevidiik

SCOPe Domain Coordinates for d1vhcc1:

Click to download the PDB-style file with coordinates for d1vhcc1.
(The format of our PDB-style files is described here.)

Timeline for d1vhcc1: