SCOP 1.67: Domain d1vhcb_: 1vhc B:

Lineage for d1vhcb_ (1vhc B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (5 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (10 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Hypothetical protein HI0047 [102092] (1 species)
   putative KHG/KDPG aldolase

7. Species Haemophilus influenzae [TaxId:727] [102093] (1 PDB entry)

8. Domain d1vhcb_: 1vhc B: [100662]

Details for d1vhcb_

PDB Entry: 1vhc, 1.89 Å

PDB Description: crystal structure of a putative khg/kdpg aldolase

SCOP Domain Sequences for d1vhcb_:

Sequence; same for both SEQRES and ATOM records:

>d1vhcb_ c.1.10.1 (B:) Hypothetical protein HI0047 {Haemophilus influenzae}
syttqqiieklrelkivpvialdnaddilpladtlaknglsvaeitfrseaaadairllr
anrpdfliaagtvltaeqvvlakssgadfvvtpglnpkivklcqdlnfpitpgvnnpmai
eialemgisavkffpaeasggvkmikallgpyaqlqimptggiglhnirdylaipnivac
ggswfvekkliqsnnwdeigrlvrevidiike

Timeline for d1vhcb_:

• d1vhcb_ is new in SCOP 1.67
  
• d1vhcb_ appears in SCOP 1.69
  
• d1vhcb_ appears in the current release, SCOPe 2.08, called d1vhcb1