SCOPe 2.06: Domain d1vhaf1: 1vha F:2-158

Lineage for d1vhaf1 (1vha F:2-158)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.1: IpsF-like [69766] (3 proteins)
   automatically mapped to Pfam PF02542

6. Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species)

7. Species Haemophilus influenzae [TaxId:727] [75479] (3 PDB entries)

8. Domain d1vhaf1: 1vha F:2-158 [100660]
   Other proteins in same PDB: d1vhaa2, d1vhab2, d1vhac2, d1vhad2, d1vhae2, d1vhaf2
   structural genomics
   complexed with acy, mn, pop

Details for d1vhaf1

PDB Entry: 1vha, 2.35 Å

PDB Description: Crystal structure of 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

PDB Compounds: (F:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d1vhaf1:

Sequence, based on SEQRES records:

>d1vhaf1 d.79.5.1 (F:2-158) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Haemophilus influenzae [TaxId: 727]}
irighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdigkl
fpdtdmqyknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaedl
qcdieqvnvkattteklgftgrqegiaceavallirq

Sequence, based on observed residues (ATOM records):

>d1vhaf1 d.79.5.1 (F:2-158) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Haemophilus influenzae [TaxId: 727]}
irighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdigkl
fpnadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaedlqcdieqv
nvkattteklgftgrqegiaceavallirq

Timeline for d1vhaf1:

• d1vhaf1 first appeared in SCOP 1.67, called d1vhaf_
  
• d1vhaf1 was called d1vhaf_ in SCOPe 2.05
  
• d1vhaf1 appears in SCOPe 2.07
  
• d1vhaf1 appears in the current release, SCOPe 2.08