![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.5: IpsF-like [69765] (2 families) ![]() forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
![]() | Family d.79.5.1: IpsF-like [69766] (3 proteins) automatically mapped to Pfam PF02542 |
![]() | Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species) |
![]() | Species Haemophilus influenzae [TaxId:727] [75479] (3 PDB entries) |
![]() | Domain d1vhac1: 1vha C:2-158 [100657] Other proteins in same PDB: d1vhaa2, d1vhab2, d1vhac2, d1vhad2, d1vhae2, d1vhaf2 structural genomics complexed with acy, mn, pop |
PDB Entry: 1vha (more details), 2.35 Å
SCOPe Domain Sequences for d1vhac1:
Sequence, based on SEQRES records: (download)
>d1vhac1 d.79.5.1 (C:2-158) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Haemophilus influenzae [TaxId: 727]} irighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdigkl fpdtdmqyknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaedl qcdieqvnvkattteklgftgrqegiaceavallirq
>d1vhac1 d.79.5.1 (C:2-158) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Haemophilus influenzae [TaxId: 727]} irighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdigkl fpknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaedlqcdieq vnvkattteklgftgrqegiaceavallirq
Timeline for d1vhac1: