Lineage for d1vhaa_ (1vha A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 414157Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 414367Superfamily d.79.5: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69765] (1 family) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 414368Family d.79.5.1: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69766] (1 protein)
  6. 414369Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (3 species)
  7. 414377Species Haemophilus influenzae [TaxId:727] [75479] (3 PDB entries)
  8. 414384Domain d1vhaa_: 1vha A: [100655]

Details for d1vhaa_

PDB Entry: 1vha (more details), 2.35 Å

PDB Description: Crystal structure of 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOP Domain Sequences for d1vhaa_:

Sequence, based on SEQRES records: (download)

>d1vhaa_ d.79.5.1 (A:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Haemophilus influenzae}
slirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdig
klfpdtdmqyknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiae
dlqcdieqvnvkattteklgftgrqegiaceavallirq

Sequence, based on observed residues (ATOM records): (download)

>d1vhaa_ d.79.5.1 (A:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Haemophilus influenzae}
slirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdig
klfpknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaedlqcdi
eqvnvkattteklgftgrqegiaceavallirq

SCOP Domain Coordinates for d1vhaa_:

Click to download the PDB-style file with coordinates for d1vhaa_.
(The format of our PDB-style files is described here.)

Timeline for d1vhaa_: