![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.5: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69765] (1 family) ![]() forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
![]() | Family d.79.5.1: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69766] (1 protein) |
![]() | Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (3 species) |
![]() | Species Haemophilus influenzae [TaxId:727] [75479] (3 PDB entries) |
![]() | Domain d1vhaa_: 1vha A: [100655] |
PDB Entry: 1vha (more details), 2.35 Å
SCOP Domain Sequences for d1vhaa_:
Sequence, based on SEQRES records: (download)
>d1vhaa_ d.79.5.1 (A:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Haemophilus influenzae} slirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdig klfpdtdmqyknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiae dlqcdieqvnvkattteklgftgrqegiaceavallirq
>d1vhaa_ d.79.5.1 (A:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Haemophilus influenzae} slirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdig klfpknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaedlqcdi eqvnvkattteklgftgrqegiaceavallirq
Timeline for d1vhaa_: