Lineage for d1vhaa1 (1vha A:2-158)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. Superfamily d.79.5: IpsF-like [69765] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. Family d.79.5.1: IpsF-like [69766] (3 proteins)
    automatically mapped to Pfam PF02542
  6. Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species)
  7. Species Haemophilus influenzae [TaxId:727] [75479] (3 PDB entries)
  8. Domain d1vhaa1: 1vha A:2-158 [100655]
    Other proteins in same PDB: d1vhaa2, d1vhab2, d1vhac2, d1vhad2, d1vhae2, d1vhaf2
    structural genomics
    complexed with acy, mn, pop

Details for d1vhaa1

PDB Entry: 1vha (more details), 2.35 Å

PDB Description: Crystal structure of 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
PDB Compounds: (A:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d1vhaa1:

Sequence, based on SEQRES records: (download)

>d1vhaa1 d.79.5.1 (A:2-158) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Haemophilus influenzae [TaxId: 727]}
irighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdigkl
fpdtdmqyknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaedl
qcdieqvnvkattteklgftgrqegiaceavallirq

Sequence, based on observed residues (ATOM records): (download)

>d1vhaa1 d.79.5.1 (A:2-158) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Haemophilus influenzae [TaxId: 727]}
irighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdigkl
fpknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaedlqcdieq
vnvkattteklgftgrqegiaceavallirq

SCOPe Domain Coordinates for d1vhaa1 are not available.

Timeline for d1vhaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vhaa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1vhab1, d1vhab2, d1vhac1, d1vhac2, d1vhad1, d1vhad2, d1vhae1, d1vhae2, d1vhaf1, d1vhaf2