Lineage for d1vh9b_ (1vh9 B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502577Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 502578Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (6 families) (S)
  5. 502657Family d.38.1.5: PaaI/YdiI-like [89902] (8 proteins)
  6. 502679Protein Hypothetical protein YbdB [102912] (1 species)
  7. 502680Species Escherichia coli [TaxId:562] [102913] (1 PDB entry)
  8. 502682Domain d1vh9b_: 1vh9 B: [100654]
    structural genomics

Details for d1vh9b_

PDB Entry: 1vh9 (more details), 2.15 Å

PDB Description: Crystal structure of a putative thioesterase

SCOP Domain Sequences for d1vh9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vh9b_ d.38.1.5 (B:) Hypothetical protein YbdB {Escherichia coli}
sliwkrhltldelnatsdntmvahlgivytrlgddvleaempvdtrthqpfgllhggasa
alaetlgsmagfmmtrdgqcvvgtelnathhrpvsegkvrgvcqplhlgrqnqsweivvf
deqgrrcctcrlgtavlg

SCOP Domain Coordinates for d1vh9b_:

Click to download the PDB-style file with coordinates for d1vh9b_.
(The format of our PDB-style files is described here.)

Timeline for d1vh9b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vh9a_