Lineage for d1vh9a1 (1vh9 A:2-137)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2188023Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2188075Protein Hypothetical protein YbdB [102912] (1 species)
  7. 2188076Species Escherichia coli [TaxId:562] [102913] (1 PDB entry)
  8. 2188077Domain d1vh9a1: 1vh9 A:2-137 [100653]
    Other proteins in same PDB: d1vh9a2, d1vh9b2
    structural genomics

Details for d1vh9a1

PDB Entry: 1vh9 (more details), 2.15 Å

PDB Description: Crystal structure of a putative thioesterase
PDB Compounds: (A:) Hypothetical protein ybdB

SCOPe Domain Sequences for d1vh9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vh9a1 d.38.1.5 (A:2-137) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]}
iwkrhltldelnatsdntmvahlgivytrlgddvleaempvdtrthqpfgllhggasaal
aetlgsmagfmmtrdgqcvvgtelnathhrpvsegkvrgvcqplhlgrqnqsweivvfde
qgrrcctcrlgtavlg

SCOPe Domain Coordinates for d1vh9a1:

Click to download the PDB-style file with coordinates for d1vh9a1.
(The format of our PDB-style files is described here.)

Timeline for d1vh9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vh9a2