Lineage for d1vh9a_ (1vh9 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721376Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 721377Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 721568Family d.38.1.5: PaaI/YdiI-like [89902] (13 proteins)
  6. 721626Protein Hypothetical protein YbdB [102912] (1 species)
  7. 721627Species Escherichia coli [TaxId:562] [102913] (1 PDB entry)
  8. 721628Domain d1vh9a_: 1vh9 A: [100653]

Details for d1vh9a_

PDB Entry: 1vh9 (more details), 2.15 Å

PDB Description: Crystal structure of a putative thioesterase
PDB Compounds: (A:) Hypothetical protein ybdB

SCOP Domain Sequences for d1vh9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]}
sliwkrhltldelnatsdntmvahlgivytrlgddvleaempvdtrthqpfgllhggasa
alaetlgsmagfmmtrdgqcvvgtelnathhrpvsegkvrgvcqplhlgrqnqsweivvf
deqgrrcctcrlgtavlg

SCOP Domain Coordinates for d1vh9a_:

Click to download the PDB-style file with coordinates for d1vh9a_.
(The format of our PDB-style files is described here.)

Timeline for d1vh9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vh9b_