SCOP 1.69: Domain d1vh8f_: 1vh8 F:

Lineage for d1vh8f_ (1vh8 F:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69765] (1 family)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.1: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69766] (1 protein)

6. Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (3 species)

7. Species Haemophilus influenzae [TaxId:727] [75479] (3 PDB entries)

8. Domain d1vh8f_: 1vh8 F: [100652]
   structural genomics

Details for d1vh8f_

PDB Entry: 1vh8, 2.35 Å

PDB Description: Crystal structure of a 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOP Domain Sequences for d1vh8f_:

Sequence, based on SEQRES records:

>d1vh8f_ d.79.5.1 (F:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Haemophilus influenzae}
slirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdig
klfpdtdmqyknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiae
dlqcdieqvnvkattteklgftgrqegiaceavallirq

Sequence, based on observed residues (ATOM records):

>d1vh8f_ d.79.5.1 (F:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Haemophilus influenzae}
slirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdig
klfpnadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaedlqcdie
qvnvkattteklgftgrqegiaceavallirq

Timeline for d1vh8f_:

• d1vh8f_ first appeared in SCOP 1.67
  
• d1vh8f_ appears in SCOP 1.71
  
• d1vh8f_ appears in the current release, SCOPe 2.08, called d1vh8f1