Lineage for d1vh8e1 (1vh8 E:2-158)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2566989Superfamily d.79.5: IpsF-like [69765] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2566990Family d.79.5.1: IpsF-like [69766] (3 proteins)
    automatically mapped to Pfam PF02542
  6. 2566991Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species)
  7. 2567037Species Haemophilus influenzae [TaxId:727] [75479] (3 PDB entries)
  8. 2567042Domain d1vh8e1: 1vh8 E:2-158 [100651]
    Other proteins in same PDB: d1vh8a2, d1vh8b2, d1vh8c2, d1vh8d2, d1vh8e2, d1vh8f2
    structural genomics
    complexed with acy, pop

Details for d1vh8e1

PDB Entry: 1vh8 (more details), 2.35 Å

PDB Description: Crystal structure of a 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
PDB Compounds: (E:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d1vh8e1:

Sequence, based on SEQRES records: (download)

>d1vh8e1 d.79.5.1 (E:2-158) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Haemophilus influenzae [TaxId: 727]}
irighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdigkl
fpdtdmqyknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaedl
qcdieqvnvkattteklgftgrqegiaceavallirq

Sequence, based on observed residues (ATOM records): (download)

>d1vh8e1 d.79.5.1 (E:2-158) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Haemophilus influenzae [TaxId: 727]}
irighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdigkl
fpnadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaedlqcdieqv
nvkattteklgftgrqegiaceavallirq

SCOPe Domain Coordinates for d1vh8e1:

Click to download the PDB-style file with coordinates for d1vh8e1.
(The format of our PDB-style files is described here.)

Timeline for d1vh8e1: