SCOPe 2.04: Domain d1vh8d_: 1vh8 D:

Lineage for d1vh8d_ (1vh8 D:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.1: IpsF-like [69766] (3 proteins)
   automatically mapped to Pfam PF02542

6. Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species)

7. Species Haemophilus influenzae [TaxId:727] [75479] (3 PDB entries)

8. Domain d1vh8d_: 1vh8 D: [100650]
   structural genomics
   complexed with acy, pop

Details for d1vh8d_

PDB Entry: 1vh8, 2.35 Å

PDB Description: Crystal structure of a 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

PDB Compounds: (D:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d1vh8d_:

Sequence, based on SEQRES records:

>d1vh8d_ d.79.5.1 (D:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Haemophilus influenzae [TaxId: 727]}
slirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdig
klfpdtdmqyknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiae
dlqcdieqvnvkattteklgftgrqegiaceavallirq

Sequence, based on observed residues (ATOM records):

>d1vh8d_ d.79.5.1 (D:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Haemophilus influenzae [TaxId: 727]}
slirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdig
klfpnadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaedlqcdie
qvnvkattteklgftgrqegiaceavallirq

Timeline for d1vh8d_:

• d1vh8d_ first appeared in SCOP 1.67
  
• d1vh8d_ appears in SCOPe 2.03
  
• d1vh8d_ appears in SCOPe 2.05
  
• d1vh8d_ appears in the current release, SCOPe 2.08, called d1vh8d1