SCOPe 2.07: Domain d1vh6b_: 1vh6 B:

Lineage for d1vh6b_ (1vh6 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.19: Flagellar export chaperone FliS [101116] (2 families)
   can form closed, open and helix-swapped bundles

5. Family a.24.19.1: Flagellar export chaperone FliS [101117] (1 protein)
   automatically mapped to Pfam PF02561

6. Protein Flagellar export chaperone FliS [101118] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [101120] (1 PDB entry)

8. Domain d1vh6b_: 1vh6 B: [100645]
   structural genomics; swapped dimer

Details for d1vh6b_

PDB Entry: 1vh6, 2.5 Å

PDB Description: crystal structure of a flagellar protein

PDB Compounds: (B:) flagellar protein FliS

SCOPe Domain Sequences for d1vh6b_:

Sequence; same for both SEQRES and ATOM records:

>d1vh6b_ a.24.19.1 (B:) Flagellar export chaperone FliS {Bacillus subtilis [TaxId: 1423]}
vntatpgeltlmlyngclkfirlaaqaienddmerknenlikaqniiqelnftlnrniel
sasmgamydymyrrlvqanikndtgmlaevegyvtdfrdawkqaiqse

Timeline for d1vh6b_:

• d1vh6b_ first appeared in SCOP 1.67
  
• d1vh6b_ appears in SCOPe 2.06
  
• d1vh6b_ appears in the current release, SCOPe 2.08