Lineage for d1vh6b_ (1vh6 B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 440553Fold a.24: Four-helical up-and-down bundle [47161] (23 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 440951Superfamily a.24.19: Flagellar export chaperone FliS [101116] (1 family) (S)
    can form closed, open and helix-swapped bundles
  5. 440952Family a.24.19.1: Flagellar export chaperone FliS [101117] (1 protein)
  6. 440953Protein Flagellar export chaperone FliS [101118] (2 species)
  7. 440960Species Bacillus subtilis [TaxId:1423] [101120] (1 PDB entry)
  8. 440962Domain d1vh6b_: 1vh6 B: [100645]
    structural genomics; swapped dimer

Details for d1vh6b_

PDB Entry: 1vh6 (more details), 2.5 Å

PDB Description: crystal structure of a flagellar protein

SCOP Domain Sequences for d1vh6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vh6b_ a.24.19.1 (B:) Flagellar export chaperone FliS {Bacillus subtilis}
vntatpgeltlmlyngclkfirlaaqaienddmerknenlikaqniiqelnftlnrniel
sasmgamydymyrrlvqanikndtgmlaevegyvtdfrdawkqaiqse

SCOP Domain Coordinates for d1vh6b_:

Click to download the PDB-style file with coordinates for d1vh6b_.
(The format of our PDB-style files is described here.)

Timeline for d1vh6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vh6a_