Lineage for d1vh6a_ (1vh6 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353428Fold a.24: Four-helical up-and-down bundle [47161] (20 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 353804Superfamily a.24.19: Flagellar export chaperone FliS [101116] (1 family) (S)
    can form closed, open and helix-swapped bundles
  5. 353805Family a.24.19.1: Flagellar export chaperone FliS [101117] (1 protein)
  6. 353806Protein Flagellar export chaperone FliS [101118] (2 species)
  7. 353813Species Bacillus subtilis [TaxId:1423] [101120] (1 PDB entry)
  8. 353814Domain d1vh6a_: 1vh6 A: [100644]

Details for d1vh6a_

PDB Entry: 1vh6 (more details), 2.5 Å

PDB Description: crystal structure of a flagellar protein

SCOP Domain Sequences for d1vh6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vh6a_ a.24.19.1 (A:) Flagellar export chaperone FliS {Bacillus subtilis}
atpgeltlmlyngclkfirlaaqaienddmerknenlikaqniiqelnftlnrnielsas
mgamydymyrrlvqanikndtgmlaevegyvtdfrdawkqai

SCOP Domain Coordinates for d1vh6a_:

Click to download the PDB-style file with coordinates for d1vh6a_.
(The format of our PDB-style files is described here.)

Timeline for d1vh6a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vh6b_