SCOP 1.75: Domain d1vh5b_: 1vh5 B:

Lineage for d1vh5b_ (1vh5 B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (14 proteins)

6. Protein Hypothetical protein YdiI [102910] (1 species)

7. Species Escherichia coli [TaxId:562] [102911] (3 PDB entries)

8. Domain d1vh5b_: 1vh5 B: [100643]
   structural genomics

Details for d1vh5b_

PDB Entry: 1vh5, 1.34 Å

PDB Description: crystal structure of a putative thioesterase

PDB Compounds: (B:) Hypothetical protein ydiI

SCOP Domain Sequences for d1vh5b_:

Sequence; same for both SEQRES and ATOM records:

>d1vh5b_ d.38.1.5 (B:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]}
sliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasv
vlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieif
dekgrlccssrlttaile

Timeline for d1vh5b_:

• d1vh5b_ first appeared in SCOP 1.67
  
• d1vh5b_ appears in SCOP 1.73
  
• d1vh5b_ appears in SCOPe 2.01
  
• d1vh5b_ appears in the current release, SCOPe 2.08, called d1vh5b1