SCOPe 2.08: Domain d1vh5b1: 1vh5 B:2-136

Lineage for d1vh5b1 (1vh5 B:2-136)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)

6. Protein Hypothetical protein YdiI [102910] (1 species)

7. Species Escherichia coli [TaxId:562] [102911] (6 PDB entries)

8. Domain d1vh5b1: 1vh5 B:2-136 [100643]
   Other proteins in same PDB: d1vh5a2, d1vh5a3, d1vh5b2, d1vh5b3
   structural genomics

Details for d1vh5b1

PDB Entry: 1vh5, 1.34 Å

PDB Description: crystal structure of a putative thioesterase

PDB Compounds: (B:) Hypothetical protein ydiI

SCOPe Domain Sequences for d1vh5b1:

Sequence; same for both SEQRES and ATOM records:

>d1vh5b1 d.38.1.5 (B:2-136) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]}
iwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvvl
aesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifde
kgrlccssrlttail

Timeline for d1vh5b1:

• d1vh5b1 first appeared in SCOP 1.67, called d1vh5b_
  
• d1vh5b1 appears in SCOPe 2.07