![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) |
![]() | Protein Hypothetical protein YdiI [102910] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [102911] (6 PDB entries) |
![]() | Domain d1vh5b1: 1vh5 B:2-136 [100643] Other proteins in same PDB: d1vh5a2, d1vh5a3, d1vh5b2, d1vh5b3 structural genomics |
PDB Entry: 1vh5 (more details), 1.34 Å
SCOPe Domain Sequences for d1vh5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vh5b1 d.38.1.5 (B:2-136) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} iwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvvl aesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifde kgrlccssrlttail
Timeline for d1vh5b1: