Lineage for d1vh5a1 (1vh5 A:2-136)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2550920Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2550976Protein Hypothetical protein YdiI [102910] (1 species)
  7. 2550977Species Escherichia coli [TaxId:562] [102911] (6 PDB entries)
  8. 2550978Domain d1vh5a1: 1vh5 A:2-136 [100642]
    Other proteins in same PDB: d1vh5a2, d1vh5a3, d1vh5b2, d1vh5b3
    structural genomics

Details for d1vh5a1

PDB Entry: 1vh5 (more details), 1.34 Å

PDB Description: crystal structure of a putative thioesterase
PDB Compounds: (A:) Hypothetical protein ydiI

SCOPe Domain Sequences for d1vh5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vh5a1 d.38.1.5 (A:2-136) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]}
iwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvvl
aesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifde
kgrlccssrlttail

SCOPe Domain Coordinates for d1vh5a1:

Click to download the PDB-style file with coordinates for d1vh5a1.
(The format of our PDB-style files is described here.)

Timeline for d1vh5a1: