Lineage for d1vh4b_ (1vh4 B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 380828Fold b.80: Single-stranded right-handed beta-helix [51125] (7 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 380993Superfamily b.80.6: Stabilizer of iron transporter SufD [101960] (1 family) (S)
    superhelix turns are made of two very long strands each
  5. 380994Family b.80.6.1: Stabilizer of iron transporter SufD [101961] (1 protein)
  6. 380995Protein Stabilizer of iron transporter SufD [101962] (1 species)
  7. 380996Species Escherichia coli [TaxId:562] [101963] (1 PDB entry)
  8. 380998Domain d1vh4b_: 1vh4 B: [100641]
    structural genomics

Details for d1vh4b_

PDB Entry: 1vh4 (more details), 1.75 Å

PDB Description: Crystal structure of a stabilizer of iron transporter

SCOP Domain Sequences for d1vh4b_:

Sequence, based on SEQRES records: (download)

>d1vh4b_ b.80.6.1 (B:) Stabilizer of iron transporter SufD {Escherichia coli}
nssnalqqwhhlfeaegtkrspqaqqhlqqllrtglptrkhenwkytpleglinsqfvsi
ageispqqrdalaltldsvrlvfvdgryvpalsdategsgyevsinddrqglpdaiqaev
flhlteslaqsvthiavkrgqrpakplllmhitqgvageevntahyrhhldlaegaeatv
iehfvslndarhftgarftinvaanahlqhiklafenplshhfahndlllaedatafshs
fllggavlrhntstqlngenstlrinslampvknevcdtrtwlehnkgfcnsrqlhktiv
sdkgravfnglinvaqhaiktdgqmtnnnllmgklaevdtkpqleiyaddvkcshgatvg
riddeqifylrsrginqqdaqqmiiyafaaeltealrdeglkqqvlarigqrlpgg

Sequence, based on observed residues (ATOM records): (download)

>d1vh4b_ b.80.6.1 (B:) Stabilizer of iron transporter SufD {Escherichia coli}
nssnalqqwhhlfeatkrspqaqqhlqqllrtglptrkhenwkytpleglinsqfvsiag
eispqqrdalaltldsvrlvfvdgryvpalsdategsgyevsinddrqglpdaiqaevfl
hlteslaqsvthiavkrgqrpakplllmhitqgvageevntahyrhhldlaegaeatvie
hfvslndarhftgarftinvaanahlqhiklafenplshhfahndlllaedatafshsfl
lggavlrhntstqlngenstlrinslampvknevcdtrtwlehnkgfcnsrqlhktivsd
kgravfnglinvaqhaiktdgqmtnnnllmgklaevdtkpqleiyaddvkcshgatvgri
ddeqifylrsrginqqdaqqmiiyafaaeltealrdeglkqqvlarigqrlpgg

SCOP Domain Coordinates for d1vh4b_:

Click to download the PDB-style file with coordinates for d1vh4b_.
(The format of our PDB-style files is described here.)

Timeline for d1vh4b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vh4a_