| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
| Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (2 proteins) contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1) automatically mapped to Pfam PF02664 |
| Protein Autoinducer-2 production protein LuxS [64295] (5 species) S-ribosylhomocysteinase |
| Species Deinococcus radiodurans [TaxId:1299] [64297] (5 PDB entries) |
| Domain d1vh2a_: 1vh2 A: [100636] structural genomics complexed with zn |
PDB Entry: 1vh2 (more details), 2 Å
SCOPe Domain Sequences for d1vh2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vh2a_ d.185.1.2 (A:) Autoinducer-2 production protein LuxS {Deinococcus radiodurans [TaxId: 1299]}
vesfdldhtkvkapyvrlagvkttpkgdqiskydlrflqpnqgaidpaaihtlehllagy
mrdhlegvvdvspmgcrtgmymavigepdeqgvmkafeaalkdtaghdqpipgvselecg
nyrdhdlaaarqhardvldqglkvqetiller
Timeline for d1vh2a_: