Lineage for d1vh2a_ (1vh2 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684578Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1684579Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1684819Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein)
    contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1)
    automatically mapped to Pfam PF02664
  6. 1684820Protein Autoinducer-2 production protein LuxS [64295] (4 species)
    S-ribosylhomocysteinase
  7. 1684829Species Deinococcus radiodurans [TaxId:1299] [64297] (5 PDB entries)
  8. 1684836Domain d1vh2a_: 1vh2 A: [100636]
    structural genomics
    complexed with zn

Details for d1vh2a_

PDB Entry: 1vh2 (more details), 2 Å

PDB Description: Crystal structure of a autoinducer-2 synthesis protein
PDB Compounds: (A:) S-ribosylhomocysteinase

SCOPe Domain Sequences for d1vh2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vh2a_ d.185.1.2 (A:) Autoinducer-2 production protein LuxS {Deinococcus radiodurans [TaxId: 1299]}
vesfdldhtkvkapyvrlagvkttpkgdqiskydlrflqpnqgaidpaaihtlehllagy
mrdhlegvvdvspmgcrtgmymavigepdeqgvmkafeaalkdtaghdqpipgvselecg
nyrdhdlaaarqhardvldqglkvqetiller

SCOPe Domain Coordinates for d1vh2a_:

Click to download the PDB-style file with coordinates for d1vh2a_.
(The format of our PDB-style files is described here.)

Timeline for d1vh2a_: