Lineage for d1vh1c_ (1vh1 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133681Family c.68.1.13: Cytidylytransferase [68901] (7 protein domains)
  6. 2133724Protein CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase [64143] (3 species)
  7. 2133725Species Escherichia coli, KdsB [TaxId:562] [102606] (1 PDB entry)
  8. 2133728Domain d1vh1c_: 1vh1 C: [100634]
    structural genomics

Details for d1vh1c_

PDB Entry: 1vh1 (more details), 2.6 Å

PDB Description: Crystal structure of CMP-KDO synthetase
PDB Compounds: (C:) 3-deoxy-manno-octulosonate cytidylyltransferase

SCOPe Domain Sequences for d1vh1c_:

Sequence, based on SEQRES records: (download)

>d1vh1c_ c.68.1.13 (C:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KdsB [TaxId: 562]}
sfvviiparyastrlpgkplvdingkpmivhvleraresgaeriivatdhedvaraveaa
ggevcmtradhqsgterlaevvekcafsddtvivnvqgdepmipatiirqvadnlaqrqv
gmatlavpihnaeeafnpnavkvvldaegyalyfsratipwdrdrfaegletvgdnflrh
lgiygyragfirryvnwqpsplehiemleqlrvlwygekihvavaqevpgtgvdtpedle
rvraem

Sequence, based on observed residues (ATOM records): (download)

>d1vh1c_ c.68.1.13 (C:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KdsB [TaxId: 562]}
sfvviiparyastrlpgkplvdingkpmivhvleraresgaeriivatdhedvaraveaa
ggevcmtqsgterlaevvekcafsddtvivnvqgdepmipatiirqvadnlaqrqvgmat
lavpihnaeeafnpnavkvvldaegyalyfsratipwdrdrfavgdnflrhlgiygyrag
firryvnwqpsplehiemleqlrvlwygekihvavaqegvdtpedlervraem

SCOPe Domain Coordinates for d1vh1c_:

Click to download the PDB-style file with coordinates for d1vh1c_.
(The format of our PDB-style files is described here.)

Timeline for d1vh1c_: