Lineage for d1vh1a_ (1vh1 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 400342Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 400343Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (13 families) (S)
  5. 400568Family c.68.1.13: Cytidylytransferase [68901] (4 proteins)
  6. 400600Protein CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase [64143] (3 species)
  7. 400601Species Escherichia coli, KdsB [TaxId:562] [102606] (1 PDB entry)
  8. 400602Domain d1vh1a_: 1vh1 A: [100632]

Details for d1vh1a_

PDB Entry: 1vh1 (more details), 2.6 Å

PDB Description: Crystal structure of CMP-KDO synthetase

SCOP Domain Sequences for d1vh1a_:

Sequence, based on SEQRES records: (download)

>d1vh1a_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KdsB}
sfvviiparyastrlpgkplvdingkpmivhvleraresgaeriivatdhedvaraveaa
ggevcmtradhqsgterlaevvekcafsddtvivnvqgdepmipatiirqvadnlaqrqv
gmatlavpihnaeeafnpnavkvvldaegyalyfsratipwdrdrfaegletvgdnflrh
lgiygyragfirryvnwqpsplehiemleqlrvlwygekihvavaqevpgtgvdtpedle
rvraem

Sequence, based on observed residues (ATOM records): (download)

>d1vh1a_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KdsB}
sfvviiparyastpgkplvdingkpmivhvleraresgaeriivatdhedvaraveaagg
evcmtrgterlaevvekcafsddtvivnvqgdepmipatiirqvadnlaqrqvgmatlav
pihnaeeafnpnavkvvldaegyalyfsratipwdrdrfaegletvgdnflrhlgiygyr
agfirryvnwqpsplehiemleqlrvlwygekihvavaqevpgtgvdtpedlervraem

SCOP Domain Coordinates for d1vh1a_:

Click to download the PDB-style file with coordinates for d1vh1a_.
(The format of our PDB-style files is described here.)

Timeline for d1vh1a_: