SCOPe 2.07: Domain d1vh0f1: 1vh0 F:2-157

Lineage for d1vh0f1 (1vh0 F:2-157)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.3: YbeA-like [82371] (5 proteins)
   Pfam PF02590

6. Protein Hypothetical protein SAV0024/SA0023 [102276] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [102277] (1 PDB entry)

8. Domain d1vh0f1: 1vh0 F:2-157 [100631]
   Other proteins in same PDB: d1vh0a2, d1vh0b2, d1vh0c2, d1vh0d2, d1vh0e2, d1vh0f2
   structural genomics

Details for d1vh0f1

PDB Entry: 1vh0, 2.31 Å

PDB Description: crystal structure of a hypothetical protein

PDB Compounds: (F:) Hypothetical UPF0247 protein SAV0024/SA0023

SCOPe Domain Sequences for d1vh0f1:

Sequence, based on SEQRES records:

>d1vh0f1 c.116.1.3 (F:2-157) Hypothetical protein SAV0024/SA0023 {Staphylococcus aureus [TaxId: 1280]}
kitilavgklkekywkqaiaeyekrlgpytkidiievpdekapenmsdkeieqvkekegq
rilakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvlqrs
nyalsfskmtfphqmmrvvlieqvyrafkimrgeay

Sequence, based on observed residues (ATOM records):

>d1vh0f1 c.116.1.3 (F:2-157) Hypothetical protein SAV0024/SA0023 {Staphylococcus aureus [TaxId: 1280]}
kitilavgklkekywkqaiaeyekrlgpytkidiievpdekapsdkeieqvkekegqril
akikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvlqrsnya
lsfskmtfphqmmrvvlieqvyrafkimrgeay

Timeline for d1vh0f1:

• d1vh0f1 first appeared in SCOP 1.67, called d1vh0f_
  
• d1vh0f1 appears in SCOPe 2.06
  
• d1vh0f1 appears in the current release, SCOPe 2.08