Lineage for d1vh0e_ (1vh0 E:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1011591Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 1011592Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 1011624Family c.116.1.3: YbeA-like [82371] (4 proteins)
    Pfam PF02590
  6. 1011625Protein Hypothetical protein SAV0024/SA0023 [102276] (1 species)
  7. 1011626Species Staphylococcus aureus [TaxId:1280] [102277] (1 PDB entry)
  8. 1011631Domain d1vh0e_: 1vh0 E: [100630]
    structural genomics

Details for d1vh0e_

PDB Entry: 1vh0 (more details), 2.31 Å

PDB Description: crystal structure of a hypothetical protein
PDB Compounds: (E:) Hypothetical UPF0247 protein SAV0024/SA0023

SCOPe Domain Sequences for d1vh0e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vh0e_ c.116.1.3 (E:) Hypothetical protein SAV0024/SA0023 {Staphylococcus aureus [TaxId: 1280]}
lkitilavgklkekywkqaiaeyekrlgpytkidiievpdekapenmsdkeieqvkekeg
qrilakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvlqr
snyalsfskmtfphqmmrvvlieqvyrafkimrgeay

SCOPe Domain Coordinates for d1vh0e_:

Click to download the PDB-style file with coordinates for d1vh0e_.
(The format of our PDB-style files is described here.)

Timeline for d1vh0e_: