SCOP 1.75: Domain d1vh0e_: 1vh0 E:

Lineage for d1vh0e_ (1vh0 E:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (8 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.3: YbeA-like [82371] (4 proteins)
   Pfam PF02590

6. Protein Hypothetical protein SAV0024/SA0023 [102276] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [102277] (1 PDB entry)

8. Domain d1vh0e_: 1vh0 E: [100630]
   structural genomics

Details for d1vh0e_

PDB Entry: 1vh0, 2.31 Å

PDB Description: crystal structure of a hypothetical protein

PDB Compounds: (E:) Hypothetical UPF0247 protein SAV0024/SA0023

SCOP Domain Sequences for d1vh0e_:

Sequence; same for both SEQRES and ATOM records:

>d1vh0e_ c.116.1.3 (E:) Hypothetical protein SAV0024/SA0023 {Staphylococcus aureus [TaxId: 1280]}
lkitilavgklkekywkqaiaeyekrlgpytkidiievpdekapenmsdkeieqvkekeg
qrilakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvlqr
snyalsfskmtfphqmmrvvlieqvyrafkimrgeay

Timeline for d1vh0e_:

• d1vh0e_ first appeared in SCOP 1.67
  
• d1vh0e_ appears in SCOP 1.73
  
• d1vh0e_ appears in SCOPe 2.01
  
• d1vh0e_ appears in the current release, SCOPe 2.08, called d1vh0e1