| Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
| Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
Superfamily c.116.1: alpha/beta knot [75217] (5 families) ![]() known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
| Family c.116.1.3: YbeA-like [82371] (3 proteins) |
| Protein Hypothetical protein SAV0024/SA0023 [102276] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [102277] (1 PDB entry) |
| Domain d1vh0c_: 1vh0 C: [100628] |
PDB Entry: 1vh0 (more details), 2.31 Å
SCOP Domain Sequences for d1vh0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vh0c_ c.116.1.3 (C:) Hypothetical protein SAV0024/SA0023 {Staphylococcus aureus}
lkitilavgklkekywkqaiaeyekrlgpytkidiievpdekapenmsdkeieqvkekeg
qrilakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvlqr
snyalsfskmtfphqmmrvvlieqvyrafkimrgeay
Timeline for d1vh0c_: