Lineage for d1vh0c_ (1vh0 C:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 404674Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 404675Superfamily c.116.1: alpha/beta knot [75217] (5 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 404702Family c.116.1.3: YbeA-like [82371] (3 proteins)
  6. 404703Protein Hypothetical protein SAV0024/SA0023 [102276] (1 species)
  7. 404704Species Staphylococcus aureus [TaxId:1280] [102277] (1 PDB entry)
  8. 404707Domain d1vh0c_: 1vh0 C: [100628]

Details for d1vh0c_

PDB Entry: 1vh0 (more details), 2.31 Å

PDB Description: crystal structure of a hypothetical protein

SCOP Domain Sequences for d1vh0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vh0c_ c.116.1.3 (C:) Hypothetical protein SAV0024/SA0023 {Staphylococcus aureus}
lkitilavgklkekywkqaiaeyekrlgpytkidiievpdekapenmsdkeieqvkekeg
qrilakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvlqr
snyalsfskmtfphqmmrvvlieqvyrafkimrgeay

SCOP Domain Coordinates for d1vh0c_:

Click to download the PDB-style file with coordinates for d1vh0c_.
(The format of our PDB-style files is described here.)

Timeline for d1vh0c_: