Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
Superfamily c.116.1: alpha/beta knot [75217] (9 families) known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
Family c.116.1.3: YbeA-like [82371] (5 proteins) Pfam PF02590 |
Protein Hypothetical protein SAV0024/SA0023 [102276] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [102277] (1 PDB entry) |
Domain d1vh0c1: 1vh0 C:2-157 [100628] Other proteins in same PDB: d1vh0a2, d1vh0b2, d1vh0c2, d1vh0d2, d1vh0e2, d1vh0f2 structural genomics |
PDB Entry: 1vh0 (more details), 2.31 Å
SCOPe Domain Sequences for d1vh0c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vh0c1 c.116.1.3 (C:2-157) Hypothetical protein SAV0024/SA0023 {Staphylococcus aureus [TaxId: 1280]} kitilavgklkekywkqaiaeyekrlgpytkidiievpdekapenmsdkeieqvkekegq rilakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvlqrs nyalsfskmtfphqmmrvvlieqvyrafkimrgeay
Timeline for d1vh0c1: