Lineage for d1vh0a1 (1vh0 A:2-157)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921212Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2921213Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2921250Family c.116.1.3: YbeA-like [82371] (5 proteins)
    Pfam PF02590
  6. 2921251Protein Hypothetical protein SAV0024/SA0023 [102276] (1 species)
  7. 2921252Species Staphylococcus aureus [TaxId:1280] [102277] (1 PDB entry)
  8. 2921253Domain d1vh0a1: 1vh0 A:2-157 [100626]
    Other proteins in same PDB: d1vh0a2, d1vh0b2, d1vh0c2, d1vh0d2, d1vh0e2, d1vh0f2
    structural genomics

Details for d1vh0a1

PDB Entry: 1vh0 (more details), 2.31 Å

PDB Description: crystal structure of a hypothetical protein
PDB Compounds: (A:) Hypothetical UPF0247 protein SAV0024/SA0023

SCOPe Domain Sequences for d1vh0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vh0a1 c.116.1.3 (A:2-157) Hypothetical protein SAV0024/SA0023 {Staphylococcus aureus [TaxId: 1280]}
kitilavgklkekywkqaiaeyekrlgpytkidiievpdekapenmsdkeieqvkekegq
rilakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvlqrs
nyalsfskmtfphqmmrvvlieqvyrafkimrgeay

SCOPe Domain Coordinates for d1vh0a1:

Click to download the PDB-style file with coordinates for d1vh0a1.
(The format of our PDB-style files is described here.)

Timeline for d1vh0a1: