Lineage for d1vgzb_ (1vgz B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 400342Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 400343Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (13 families) (S)
  5. 400568Family c.68.1.13: Cytidylytransferase [68901] (4 protein domains)
  6. 400569Protein 4-diphosphocytidyl-2-c-methylerythritol (CDP-me) synthase (YgbP) [64140] (2 species)
  7. 400580Species Neisseria gonorrhoeae [102605] (2 PDB entries)
  8. 400588Domain d1vgzb_: 1vgz B: [100625]
    structural genomics
    complexed with so4

Details for d1vgzb_

PDB Entry: 1vgz (more details), 3 Å

PDB Description: crystal structure of 4-diphosphocytidyl-2c-methyl-d-erythritol synthase

SCOP Domain Sequences for d1vgzb_:

Sequence, based on SEQRES records: (download)

>d1vgzb_ c.68.1.13 (B:) 4-diphosphocytidyl-2-c-methylerythritol (CDP-me) synthase (YgbP) {Neisseria gonorrhoeae}
krknialipaagigvrfgadkpkqyveigsktvlehvlgiferheavdltvvvvspedtf
adkvqtafpqvrvwknggqtraetvrngvaklletglaaetdnilvhdaarcclpseala
rlieqagnaaeggilavpvadtlkraesgqisatvdrsglwqaqtpqlfqagllhralaa
enlggitdeasaveklgvrplliqgdarnlkltqpqdayivrllld

Sequence, based on observed residues (ATOM records): (download)

>d1vgzb_ c.68.1.13 (B:) 4-diphosphocytidyl-2-c-methylerythritol (CDP-me) synthase (YgbP) {Neisseria gonorrhoeae}
krknialipapkqyveigsktvlehvlgiferheavdltvvvvspedtfadkvqtafpqv
rvwknggqtraetvrngvaklletglaaetdnilvhdaarcclpsealarlieqagnaae
ggilavpvadtlkraesgqisatvdrsglwqaqtpqlfqagllhralaaitdeasavekl
gvrplliqgdarnlkltqpqdayivrllld

SCOP Domain Coordinates for d1vgzb_:

Click to download the PDB-style file with coordinates for d1vgzb_.
(The format of our PDB-style files is described here.)

Timeline for d1vgzb_: