Lineage for d1vgyb2 (1vgy B:181-293)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 604578Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) (S)
  5. 604579Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (6 proteins)
  6. 604610Protein Succinyl-diaminopimelate desuccinylase [103005] (1 species)
  7. 604611Species Neisseria meningitidis [TaxId:487] [103006] (1 PDB entry)
  8. 604613Domain d1vgyb2: 1vgy B:181-293 [100623]
    Other proteins in same PDB: d1vgya1, d1vgyb1
    structural genomics
    mutant

Details for d1vgyb2

PDB Entry: 1vgy (more details), 1.9 Å

PDB Description: crystal structure of succinyl diaminopimelate desuccinylase

SCOP Domain Sequences for d1vgyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgyb2 d.58.19.1 (B:181-293) Succinyl-diaminopimelate desuccinylase {Neisseria meningitidis}
gslsgnltvkgkqghiayphlainpvhtfapalleltqevwdegneyfpptsfqisning
gtgatnvipgelnvkfnfrfstesteaglkqrvhaildkhgvqydlqwscsgq

SCOP Domain Coordinates for d1vgyb2:

Click to download the PDB-style file with coordinates for d1vgyb2.
(The format of our PDB-style files is described here.)

Timeline for d1vgyb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vgyb1