![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) ![]() |
![]() | Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins) |
![]() | Protein Succinyl-diaminopimelate desuccinylase [103005] (1 species) |
![]() | Species Neisseria meningitidis [TaxId:487] [103006] (1 PDB entry) |
![]() | Domain d1vgyb2: 1vgy B:181-293 [100623] Other proteins in same PDB: d1vgya1, d1vgyb1 structural genomics |
PDB Entry: 1vgy (more details), 1.9 Å
SCOPe Domain Sequences for d1vgyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vgyb2 d.58.19.1 (B:181-293) Succinyl-diaminopimelate desuccinylase {Neisseria meningitidis [TaxId: 487]} gslsgnltvkgkqghiayphlainpvhtfapalleltqevwdegneyfpptsfqisning gtgatnvipgelnvkfnfrfstesteaglkqrvhaildkhgvqydlqwscsgq
Timeline for d1vgyb2: