Lineage for d1vgyb1 (1vgy B:2-180,B:294-376)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 587177Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 587552Superfamily c.56.5: Zn-dependent exopeptidases [53187] (6 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 587640Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (12 proteins)
  6. 587705Protein Succinyl-diaminopimelate desuccinylase, catalytic domain [102509] (1 species)
  7. 587706Species Neisseria meningitidis [TaxId:487] [102510] (1 PDB entry)
  8. 587708Domain d1vgyb1: 1vgy B:2-180,B:294-376 [100622]
    Other proteins in same PDB: d1vgya2, d1vgyb2
    structural genomics
    mutant

Details for d1vgyb1

PDB Entry: 1vgy (more details), 1.9 Å

PDB Description: crystal structure of succinyl diaminopimelate desuccinylase

SCOP Domain Sequences for d1vgyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgyb1 c.56.5.4 (B:2-180,B:294-376) Succinyl-diaminopimelate desuccinylase, catalytic domain {Neisseria meningitidis}
tetqslelakelisrpsvtpddrdcqklmaerlhkigfaaeemhfgntkniwlrrgtkap
vvcfaghtdvvptgpvekwdsppfepaerdgrlygrgaadmktsiacfvtacerfvakhp
nhqgsiallitsdeegdaldgttkvvdvlkardelidycivgeptavdklgdmikngrrX
pfltqagkltdvaraaiaetcgieaelsttggtsdgrfikamaqelielgpsnatihqin
envrlndipklsavyegilvrll

SCOP Domain Coordinates for d1vgyb1:

Click to download the PDB-style file with coordinates for d1vgyb1.
(The format of our PDB-style files is described here.)

Timeline for d1vgyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vgyb2