Lineage for d1vgya2 (1vgy A:181-293)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2521258Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) (S)
  5. 2521259Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins)
  6. 2521301Protein Succinyl-diaminopimelate desuccinylase [103005] (1 species)
  7. 2521302Species Neisseria meningitidis [TaxId:487] [103006] (1 PDB entry)
  8. 2521303Domain d1vgya2: 1vgy A:181-293 [100621]
    Other proteins in same PDB: d1vgya1, d1vgyb1
    structural genomics

Details for d1vgya2

PDB Entry: 1vgy (more details), 1.9 Å

PDB Description: crystal structure of succinyl diaminopimelate desuccinylase
PDB Compounds: (A:) succinyl-diaminopimelate desuccinylase

SCOPe Domain Sequences for d1vgya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgya2 d.58.19.1 (A:181-293) Succinyl-diaminopimelate desuccinylase {Neisseria meningitidis [TaxId: 487]}
gslsgnltvkgkqghiayphlainpvhtfapalleltqevwdegneyfpptsfqisning
gtgatnvipgelnvkfnfrfstesteaglkqrvhaildkhgvqydlqwscsgq

SCOPe Domain Coordinates for d1vgya2:

Click to download the PDB-style file with coordinates for d1vgya2.
(The format of our PDB-style files is described here.)

Timeline for d1vgya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vgya1